Scaffold JGI25616J43925_10346875

Overview

Basic Information

• Taxon OID: 3300002917
• Scaffold ID: JGI25616J43925_10346875
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Yersinia → Yersinia pseudotuberculosis complex → Yersinia pestis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Laytonville, California, USA
• Coordinates
  • Lat. (^o): 39.7392
  • Long. (^o): -123.6308

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021381	Metagenome / Metatranscriptome	219	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25616J43925_103468751	F021381	N/A	KETPQASLVQKKPAPKPAPDKVENLAKEYLAELKEVDVTFEKGTAVLEKYRAKYPELASYIREIVPGERRIEIRQRLEGEDISLHLFAIRVLEDEVRYEVKLSGDAEHKTVKPPEWLSLLHDKLARIVAKILYARETSKPEKQDLDLSGPAA*