NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25617J43924_10251722

Scaffold JGI25617J43924_10251722


Overview

Basic Information
Taxon OID3300002914 Open in IMG/M
Scaffold IDJGI25617J43924_10251722 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)598
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002414Metagenome / Metatranscriptome561Y
F006480Metagenome / Metatranscriptome372Y

Sequences

Protein IDFamilyRBSSequence
JGI25617J43924_102517221F002414N/AMIRVVRETYETPESVAQRLERAGGRNRFGEANYRAVWGWNRLAWIGGKFEERDPATGSFLREVVELRQEPKYAAVNRWHIERWVPPEV
JGI25617J43924_102517222F006480N/AMRRVFIGGITLLLCGVISARSKPEPLVFVFLRVDREQDIAILRPMIAPDIGVQLDSGPRTLQPGTVLRCEASAREHSAIVEGQVAKVSDLMLDCGNNKFVVKTLEFSPHAK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.