NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26060J43896_10054036

Scaffold JGI26060J43896_10054036


Overview

Basic Information
Taxon OID3300002913 Open in IMG/M
Scaffold IDJGI26060J43896_10054036 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1124
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-37.9831Long. (o)-44.9892Alt. (m)Depth (m)754
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009369Metagenome / Metatranscriptome319N
F020253Metagenome / Metatranscriptome225Y

Sequences

Protein IDFamilyRBSSequence
JGI26060J43896_100540362F020253AGGAGMGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA*
JGI26060J43896_100540363F009369GAGGMPKGPKQFHNLTSSDQMVYFDWMNALIDDGQIDPSIDNDAYIDKMERMHKCDVNQTEPEWPFFDGNNYFDPTEEENI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.