Scaffold JGI25390J43892_10109325

Overview

Basic Information

• Taxon OID: 3300002911
• Scaffold ID: JGI25390J43892_10109325
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 625
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Angelo Coastal Reserve, California, USA
• Coordinates
  • Lat. (^o): 39.73825
  • Long. (^o): -123.6301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006582	Metagenome / Metatranscriptome	369	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25390J43892_101093252	F006582	GGA	MAPITLQRLIKQLDKLKPEADAARLKTHDYARWLARMIRRLRERSLDADRAAATVALAEALKRGAIRAPMEAHAHKRPGLAR*