Scaffold JGI25382J43887_10062121

Overview

Basic Information

• Taxon OID: 3300002908
• Scaffold ID: JGI25382J43887_10062121
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2022
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Angelo Coastal Reserve, California, USA
• Coordinates
  • Lat. (^o): 39.718176
  • Long. (^o): -123.652732

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026838	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25382J43887_100621212	F026838	AGGAGG	MFLYWLVFALVFGNPRQKSSKPEEQAVAQQQASALYERHRQAAIRMNELAARINSAADARAFVDAVADMFADSLPPAWATRGIRERIARAEYEAVSDPLRQVPEQRIADVWNKYVREIGASEEAIVTAAEIHSMRDATFAVGQVMWSRGKSQTAWTMPNIFAVGVDGKLAEGCRAVEAIRIIHDLDGLFDNLRSARERLRKGIVASETIKKSLENTNANQKITARLEGHVDTNPLRPAEHRYVREHGADHFNQLLEMLFEELFPADQQASSKAP*