NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25613J43889_10000753

Scaffold JGI25613J43889_10000753


Overview

Basic Information
Taxon OID3300002907 Open in IMG/M
Scaffold IDJGI25613J43889_10000753 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7828
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014795Metagenome260Y
F102675Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
JGI25613J43889_100007533F102675AGGAGMRYERQKMIRKELERIPRGLKGSPQNEVRQIVTSQYQHRKSFDESVEIAVNFVRQRYPNFTSKILPPPSQT*
JGI25613J43889_100007534F014795GAGGMYRLFHDGEAPTTLRKLKPPKDDEFGSRGAQADYLSKLRRLLAKMEPDDQNLLLHMAQRVARG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.