Scaffold JGI24803J43973_1005216

Overview

Basic Information

• Taxon OID: 3300002902
• Scaffold ID: JGI24803J43973_1005216
• Source Dataset Name: Soil microbial communities from Manhattan, Kansas, USA - Sample 400um Nextera
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa)

Source Dataset Sampling Location

• Location Name: Manhattan, Kansas, USA
• Coordinates
  • Lat. (^o): 39.214
  • Long. (^o): -96.5852
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002103	Metagenome / Metatranscriptome	593	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24803J43973_10052161	F002103	GAG	MSTDEPFRTDYEXLKGVDYIFVSLDRNLSGEECHELAEKYFETHKGMTLPGQALRVDLRPAFRKPLADVTPKFRAVSIGYTFTPQR*