| Basic Information | |
|---|---|
| Taxon OID | 3300002899 Open in IMG/M |
| Scaffold ID | JGIcombinedJ43975_10032054 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 859 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Manhattan, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.214 | Long. (o) | -96.5852 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015450 | Metagenome / Metatranscriptome | 254 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGIcombinedJ43975_100320541 | F015450 | N/A | LCSLLLWIMKMLLTKTVFVQSMLLSKALKMQQDLEDKKHEAIIGNLESKIKEQSVIIEKKDFELQSTEGLLAETEAKISELNSKLIGQSKQFEQEKLELNSKLEAEVQANSNLKKSLTSLQDKCLNFSNNCIQQLKKIFYSVGASSGKFTPSDEDLPKAFDHIEAEIEELDEVIAGHGDFCAWVASRGTAAAFLKAGCEHGKIVNRPNFALSPSILDDIPDLARSISNRFIKMIWTKGGREKAGDEARSHLEPVRNHTLYLPSPSHLIFTXDTLIHVG* |
| ⦗Top⦘ |