Basic Information | |
---|---|
Taxon OID | 3300002899 Open in IMG/M |
Scaffold ID | JGIcombinedJ43975_10002745 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2800 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Manhattan, Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.214 | Long. (o) | -96.5852 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002553 | Metagenome / Metatranscriptome | 549 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGIcombinedJ43975_100027451 | F002553 | AGG | MHRIQFREIMRDAQVAHAIHPVVVKYLLNVEDTTKALMTCGVPRAANVAQI |
⦗Top⦘ |