| Basic Information | |
|---|---|
| Taxon OID | 3300002898 Open in IMG/M |
| Scaffold ID | draft_10165927 Open in IMG/M |
| Source Dataset Name | Metagenome Biopara biogasfermenter May 2013 pooled |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1346 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | 50.823236 | Long. (o) | 7.142629 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019116 | Metagenome / Metatranscriptome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_101659271 | F019116 | AGGAGG | MTKKKTSIMLSARDKKLLELLAKKEARSQTKELEYLIRRRAEELELKIKEP* |
| ⦗Top⦘ |