NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24802J43972_1000323

Scaffold JGI24802J43972_1000323


Overview

Basic Information
Taxon OID3300002896 Open in IMG/M
Scaffold IDJGI24802J43972_1000323 Open in IMG/M
Source Dataset NameSoil microbial communities from Manhattan, Kansas, USA - Sample 300um Nextera
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2528
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa)

Source Dataset Sampling Location
Location NameManhattan, Kansas, USA
CoordinatesLat. (o)39.214Long. (o)-96.5852Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040007Metagenome162Y

Sequences

Protein IDFamilyRBSSequence
JGI24802J43972_10003232F040007AGAAGGMPLESNSAASVSPALVFELENGSSFTFNFQMDGRVTVIGFQEGRAVTGTLTEEQAEELRDAIGEYIHKRKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.