| Basic Information | |
|---|---|
| Taxon OID | 3300002879 Open in IMG/M |
| Scaffold ID | HEA_1012533 Open in IMG/M |
| Source Dataset Name | Assembled contigs of human gut microbial metagenome from Inflammatory Bowel Disease and Treatment (7 pooled healthy) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Harvard University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 682 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Harvard School of Public Health, Boston, MA | |||||||
| Coordinates | Lat. (o) | 42.335579 | Long. (o) | -71.102733 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059106 | Metagenome | 134 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| HEA_10125332 | F059106 | N/A | MHAIVWKIRVILLQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV* |
| ⦗Top⦘ |