Basic Information | |
---|---|
Taxon OID | 3300002879 Open in IMG/M |
Scaffold ID | HEA_1012533 Open in IMG/M |
Source Dataset Name | Assembled contigs of human gut microbial metagenome from Inflammatory Bowel Disease and Treatment (7 pooled healthy) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Harvard University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 682 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Harvard School of Public Health, Boston, MA | |||||||
Coordinates | Lat. (o) | 42.335579 | Long. (o) | -71.102733 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059106 | Metagenome | 134 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
HEA_10125332 | F059106 | N/A | MHAIVWKIRVILLQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV* |
⦗Top⦘ |