Scaffold HEA_1012533

Overview

Basic Information

• Taxon OID: 3300002879
• Scaffold ID: HEA_1012533
• Source Dataset Name: Assembled contigs of human gut microbial metagenome from Inflammatory Bowel Disease and Treatment (7 pooled healthy)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Harvard University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 682
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health

Source Dataset Sampling Location

• Location Name: Harvard School of Public Health, Boston, MA
• Coordinates
  • Lat. (^o): 42.335579
  • Long. (^o): -71.102733

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059106	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
HEA_10125332	F059106	N/A	MHAIVWKIRVILLQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV*