Scaffold draft_11481993

Overview

Basic Information

• Taxon OID: 3300002856
• Scaffold ID: draft_11481993
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1686
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Syncrude tailings pond, Wood Buffalo, Alberta, Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029455	Metagenome / Metatranscriptome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_114819934	F029455	GGAG	MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRLLLILGGWMKP*