Scaffold draft_11437666

Overview

Basic Information

• Taxon OID: 3300002856
• Scaffold ID: draft_11437666
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1110
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Syncrude tailings pond, Wood Buffalo, Alberta, Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039036	Metagenome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_114376662	F039036	GGGGG	MTTFQIAIRKVGIHCAKPIWSFIRNCVFWLFRLNDVNEVRKIKADIKYLSIETLMERFIWKEDAGGDWTPWVMTIIGQSFKDDCDGAAALAKWWFKQNGVEAEILNFYSATEGHTICVTKDRETMVTNERVVMLHPDNWKKEVLEYFNNKYEVII*