Scaffold draft_1024447

Overview

Basic Information

• Taxon OID: 3300002853
• Scaffold ID: draft_1024447
• Source Dataset Name: PDIso9.ppmwps2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Kootenay National Park, British Columbia
• Coordinates
  • Lat. (^o): 51.17
  • Long. (^o): -116.16
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039222	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_10244472	F039222	N/A	CIRDRRYENFLAALADWARVKEQWLGEKKIDLQSRLRDIERRLSLQLRRMRLLQAQLV*