Basic Information | |
---|---|
Taxon OID | 3300002853 Open in IMG/M |
Scaffold ID | draft_1021981 Open in IMG/M |
Source Dataset Name | PDIso9.ppmwps2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 565 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kootenay National Park, British Columbia | |||||||
Coordinates | Lat. (o) | 51.17 | Long. (o) | -116.16 | Alt. (m) | Depth (m) | .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008403 | Metagenome | 334 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_10219811 | F008403 | N/A | MLEITELRRRIAKLKFEHASAVIIDELEAQLRILKAIYDSAVQLHAAGEADPSLQAAFRQRDLGDWTLENVYFFVYEQAVALAPDGHDLATLIWHQDYATPLRSEVLAK* |
⦗Top⦘ |