| Basic Information | |
|---|---|
| Taxon OID | 3300002845 Open in IMG/M |
| Scaffold ID | contig_10533 Open in IMG/M |
| Source Dataset Name | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Crim Dell |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 601 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Williamsburg, VA | |||||||
| Coordinates | Lat. (o) | 37.270661 | Long. (o) | -76.7142 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071155 | Metagenome / Metatranscriptome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| contig_105332 | F071155 | N/A | WDKQRKGDEHMRHGIDYKKVHCKVGDKVPVYPFSWLGEPFVGIVEKVKMNQFGRVSYVIGNREVFAEELLPAVGQEKLRMRACT* |
| ⦗Top⦘ |