Basic Information | |
---|---|
Taxon OID | 3300002844 Open in IMG/M |
Scaffold ID | contig_10459 Open in IMG/M |
Source Dataset Name | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Jamestown High School |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 646 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Williamsburg, Virginia | |||||||
Coordinates | Lat. (o) | 37.251274 | Long. (o) | -76.791915 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074571 | Metagenome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
contig_104592 | F074571 | GAG | MSILNPYVLLGIVLSILSAFGGGYWKGSKDEVTRQQLEIAKLNAEARQKEQALLSAVTTQATKLQKANQDA |
⦗Top⦘ |