Scaffold contig_10045

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold contig_10045

Scaffold contig_10045

Overview

Basic Information
Taxon OID	3300002844 Open in IMG/M
Scaffold ID	contig_10045 Open in IMG/M
Source Dataset Name	Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Jamestown High School
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3651
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (10.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va

Source Dataset Sampling Location
Location Name	USA: Williamsburg, Virginia
Coordinates	Lat. (^o)	37.251274	Long. (^o)	-76.791915	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008751	Metagenome / Metatranscriptome	328	Y

Sequences

Protein ID	Family	RBS	Sequence
contig_100454	F008751	N/A	MDSLIIFLIGQAVTILIGLIGIYVKVSLKLKELEIRVNVVEKQDDLISRKLDTIANQINNLCVQIQNKQDRE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.