Scaffold contig_10134

Overview

Basic Information

• Taxon OID: 3300002843
• Scaffold ID: contig_10134
• Source Dataset Name: Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Greensprings
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1530
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va

Source Dataset Sampling Location

• Location Name: Jamestown, Virginia, United States
• Coordinates
  • Lat. (^o): 37.248966
  • Long. (^o): -76.787831
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066497	Metagenome	126	N

Sequences

Protein ID	Family	RBS	Sequence
contig_101344	F066497	GGA	MNQAEYQDWKLHPVTVEFFSHLKKAKQETMESWANRQFTTEGDNQFALGGIYAINQIIDLDYADIAGE*