Scaffold bg3kmer60_1097213

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold bg3kmer60_1097213

Scaffold bg3kmer60_1097213

Overview

Basic Information
Taxon OID	3300002837 Open in IMG/M
Scaffold ID	bg3kmer60_1097213 Open in IMG/M
Source Dataset Name	Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	563
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Source Dataset Sampling Location
Location Name	Sweden: Sk?ne County
Coordinates	Lat. (^o)	55.656904	Long. (^o)	13.082968	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018909	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
bg3kmer60_10972131	F018909	AGGAGG	MKWIKTAIGAVIAISVVPMVVGVITELTGTGGALEGTVAGVLLDLAPIVFVAGILSFLFLKTGTRN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.