NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold bg3kmer60_1024773

Scaffold bg3kmer60_1024773


Overview

Basic Information
Taxon OID3300002837 Open in IMG/M
Scaffold IDbg3kmer60_1024773 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1675
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Source Dataset Sampling Location
Location NameSweden: Sk?ne County
CoordinatesLat. (o)55.656904Long. (o)13.082968Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020859Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
bg3kmer60_10247732F020859AGGAGGMKKIIAKELNPAHVDFSFYFDNDGLKSIGGENCAVYIIPADRRRYHGFNMDEYEYIEGQAEAIIDGFHDVNNKWTNGYNSFATYKEAMEYNGIPYTSRKCHLLKKWAEHANPYDTNDIAKFLTITTGEEWVVKSFTGYSQGDYCEVVYCVSRHTPEHINEIGKFWLGCGTEFCIDDCYGYYVPDTIRWEEGETLRKYLADCYGCKPDELEVYLYDGEHVVTDYKIMD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.