NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J40625_100001544

Scaffold B570J40625_100001544


Overview

Basic Information
Taxon OID3300002835 Open in IMG/M
Scaffold IDB570J40625_100001544 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42361
Total Scaffold Genes91 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)68 (74.73%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007110Metagenome / Metatranscriptome357Y
F007305Metagenome / Metatranscriptome353Y
F085623Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
B570J40625_10000154451F007110GGAGGMNCIYCQENVGFDRYEFLVETGRKIICKDCSVENRAVGFLSYSHKTAPELVMIPANNKEEIRRCKRVNRRAR*
B570J40625_10000154452F007305GGAMKIINKTIRKAYNNWNPCKAIRCYHFSAAFHGTKLICFTKNNPIKTHAGAYRIGEDFNLEKYKEFPYYHSESRLISKLLDQYNTIDSNWSVVVLRINRKGLILGSKPCKNCNKLLSAVGLNTIYYSTDDGNFIDNFGNLIEGNQLTVPMVMV*
B570J40625_10000154490F085623N/AVGQVPKFVTKLRTIILEYDLIEIHHNKKLKNKPYLVRVFSYNNTDPHELRLNEDDLKNLYNILKEYKYL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.