NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J40625_100001304

Scaffold B570J40625_100001304


Overview

Basic Information
Taxon OID3300002835 Open in IMG/M
Scaffold IDB570J40625_100001304 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)45689
Total Scaffold Genes74 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (17.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010163Metagenome / Metatranscriptome307Y
F019658Metagenome / Metatranscriptome228Y
F059360Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
B570J40625_10000130424F059360N/AMIMTLIKKVLVPANLVPAAAVIREGQALSVITGRIVSVDCNISYILKFKA*
B570J40625_10000130440F019658N/AMKTNRIRNRNYKLFKYNLLKLQVYSNQHHFKVAHFSNNILEQIETYLKQVLKIIFEYHVWHFKILFIGFPVVSKMRQMKLLHFTNHNFISEKS*MSGVLRNRFSILTYLQLIESRNFSKSLKLLLTIKTKPQLVVMFNQKVETNTINEFYKAGIPIISFN*NSLNSLKIAYHTLGNFNFVERNIKLTFFFLFYSLLKKTPVKKRKKLRQHPF*
B570J40625_10000130460F010163N/AMEFI*IKIISKFMLLLKIAKNSFFSQNTITHNYIRHTFHTINALEFMKEETFSYYVQ*LLLL*FTNLSHLRIKTNYFISYMYFSFINNQKLLSYVINISLSLTNTLINVNNINGNPKFFYSAGMFNLQKKQKTRQPKAIITILRALLLKSKFFKTKPAAVHFNNLFFKHQSSIFKKLKRKIFAKLVISYLYKAHNGCRLRKKKRIKIRTRTRKL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.