| Basic Information | |
|---|---|
| Taxon OID | 3300002834 Open in IMG/M |
| Scaffold ID | JGI24696J40584_12806064 Open in IMG/M |
| Source Dataset Name | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 879 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Petit - Saut dam, French Guiana | |||||||
| Coordinates | Lat. (o) | 5.0626 | Long. (o) | -53.0462 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032694 | Metagenome | 179 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24696J40584_128060643 | F032694 | GGA | MGVKRKPDIIDIIEQKRLLWYGHVERMPEERIPKLIVVWVP |
| ⦗Top⦘ |