Scaffold Iso3TCLC_10077802

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Iso3TCLC_10077802

Scaffold Iso3TCLC_10077802

Overview

Basic Information
Taxon OID	3300002821 Open in IMG/M
Scaffold ID	Iso3TCLC_10077802 Open in IMG/M
Source Dataset Name	Iso-alkanes.Hi.seq-Iso3T
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2204
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Athabasca Oil Sands, Alberta Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054063	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Iso3TCLC_100778021	F054063	AGG	MDINVKLKYTSTIMNAWLYGVENTANIFFDKPKLFYRRWGTIAIRPFIESWKDLEMEFQKGLSPYNTAKMFIEALVKSNFMNEEDFDMSGDDNNFTFKAINCPYKSHCSRLIDEGKEIACLRAITFLGAMEFNKEGESLKYMYKFEFNKETPCLVSFEKFKD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.