| Basic Information | |
|---|---|
| Taxon OID | 3300002821 Open in IMG/M |
| Scaffold ID | Iso3TCLC_10005082 Open in IMG/M |
| Source Dataset Name | Iso-alkanes.Hi.seq-Iso3T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 246881 |
| Total Scaffold Genes | 230 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 45 (19.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Proteiniphilum → Proteiniphilum acetatigenes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Athabasca Oil Sands, Alberta Canada | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088079 | Metagenome / Metatranscriptome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Iso3TCLC_10005082200 | F088079 | N/A | MLTEKAIWLENVPFRNIDEAIGGQNCSVYFVESMFVGQSCTFCTSRLGNLAPNPYRMLTRLDVFIHICEIYKVDITFFKSNVVSTK* |
| ⦗Top⦘ |