Scaffold Ga0005234J37281_1005134

Overview

Basic Information

• Taxon OID: 3300002776
• Scaffold ID: Ga0005234J37281_1005134
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_B (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6388
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (77.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.7299
  • Long. (^o): -123.5699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059474	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0005234J37281_10051347	F059474	AGG	MAFKAIDRNEVIEAVSVDDPAIDQNNSDIEAYKDSHDIKHLSFIEGEQPTVFHIGTISFMKFAEIKDKHISFDLGGEGQEIKTNLFGLTADALRYSLKKADNLPFKIKIERNRLSDTTMDKLARLGIVEELGNVALNVNGFGDEEEKK*