| Basic Information | |
|---|---|
| Taxon OID | 3300002760 Open in IMG/M |
| Scaffold ID | JGI25136J39404_1042369 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Pacific Ocean - ETNP_6_1000 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 841 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Hahellaceae → Hahella → Hahella ganghwensis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 18.92 | Long. (o) | -104.89 | Alt. (m) | Depth (m) | 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013189 | Metagenome / Metatranscriptome | 273 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI25136J39404_10423691 | F013189 | AGGA | MEIERADIRTGLDHTTAKNVAEHLDKKYPGWLWAVHVMDGVVVVKSMLLSGNWGFVLHEDKIDNDYRAVTLAGGEIXERYKQKTNGFNQERYMDLTMDYKGQXDGDLSPGTA* |
| ⦗Top⦘ |