| Basic Information | |
|---|---|
| Taxon OID | 3300002703 Open in IMG/M |
| Scaffold ID | draft_11071530 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3524 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Suncor Tailings Pond 6, Northern Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056712 | Metagenome / Metatranscriptome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_110715306 | F056712 | AGG | MRVSTGTSTAGIVGLLEKIEKRLVLRLMKSSGKQPFLLVFIIVFLSMNKKGKRKVEPEKDENYWRVLGG |
| ⦗Top⦘ |