Scaffold draft_10917924

Overview

Basic Information

• Taxon OID: 3300002703
• Scaffold ID: draft_10917924
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 675
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Suncor Tailings Pond 6, Northern Alberta, Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073228	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
draft_109179242	F073228	GGAGG	MAITIGDIMDANNSKYGEFLYRIVMVFPHNMEVDKTELARLIKISNNTLTFERKNGEKFTIDERDIEHIDLFKSPNYKGGI*