Scaffold draft_10479821

Overview

Basic Information

• Taxon OID: 3300002702
• Scaffold ID: draft_10479821
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 30898
• Total Scaffold Genes: 38
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 35 (92.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Fort McMurray, Alberta, Canda
• Coordinates
  • Lat. (^o): 55.07
  • Long. (^o): -110.53

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025668	Metagenome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_1047982122	F025668	GGAGG	MIKLSIIEAQDYLRVKTEDGYKRIVDIHSLLKSHSINEVVLFLKDYLREKENSLRNMILIDKTHCKVDQIVASMFRITMAIKALKEGEEVISLEESQQRAETRRTIHKRNSRGHRSSWKRENKNHDGKNRVSGNPAKRAA*