NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24137J36423_1002498

Scaffold JGI24137J36423_1002498


Overview

Basic Information
Taxon OID3300002565 Open in IMG/M
Scaffold IDJGI24137J36423_1002498 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5669
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow, Alaska, USA
CoordinatesLat. (o)71.290565Long. (o)-156.788622Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080675Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
JGI24137J36423_10024983F080675N/AVLETVTLVLERAGEPMRAREIHAAACELVGEQLLWKSVKAALAACAVGNEACFERVRRGYYRIKENRVR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.