| Basic Information | |
|---|---|
| Taxon OID | 3300002553 Open in IMG/M |
| Scaffold ID | JakoDRAFT_10008535 Open in IMG/M |
| Source Dataset Name | Bacteria associated with jakobid flagellates |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Genome Quebec |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1652 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Unclassified → Unclassified → Unclassified → Unclassified → Freshwater Jakobid Flagellates Associated → Freshwater Jakobid Flagellates Associated Microbial Communities From Zagora City, Morocco |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eastern part of Anti-Atlas mountain range near Zagora City, Morocco | |||||||
| Coordinates | Lat. (o) | 30.350367 | Long. (o) | -5.836196 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018530 | Metagenome / Metatranscriptome | 234 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JakoDRAFT_100085351 | F018530 | GAG | MTNVNRDTLQGLPGVTPMFQAFVQSVRLYTRDFPELNRLLSGEESTDRQIAWSVLDAVSDFNGTPHFTTLSLDDLLGRSLQYLLLRMTVISLIEQVGLLQTRNHINYSTGGINVGINDKTPLLMNWLQYFRAFTDQRKQQVKVALNIEGILGPTNSGVFSEYWAVNSTYAQF* |
| ⦗Top⦘ |