Scaffold JGI24973J35851_1034967

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24973J35851_1034967

Scaffold JGI24973J35851_1034967

Overview

Basic Information
Taxon OID	3300002547 Open in IMG/M
Scaffold ID	JGI24973J35851_1034967 Open in IMG/M
Source Dataset Name	Polar desert microbial communities from Antarctic Dry Valleys - UQ889
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	659
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location Name	Antarctic Dry Valleys
Coordinates	Lat. (^o)	-78.1358	Long. (^o)	164.1187	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023526	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24973J35851_10349672	F023526	AGGAGG	MTSGYIPPKDEPGQDEILEALGAALNDNPRLADMPEEEVARQLVLEGRLETEPAPPLVAEALRTIESEEGGTT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.