Scaffold JGI24973J35851_1009489

Overview

Basic Information

• Taxon OID: 3300002547
• Scaffold ID: JGI24973J35851_1009489
• Source Dataset Name: Polar desert microbial communities from Antarctic Dry Valleys - UQ889
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1560
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctic Dry Valleys
• Coordinates
  • Lat. (^o): -78.1358
  • Long. (^o): 164.1187
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089628	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24973J35851_10094891	F089628	AGG	MNRPRPLLPPGTQVRTAAADREQHGVVLPYDQQYSWGTFPVLCADGITRRRSAAECVVLERDGPAPGNSTATDTARS*