| Basic Information | |
|---|---|
| Taxon OID | 3300002521 Open in IMG/M |
| Scaffold ID | D14S2_10064534 Open in IMG/M |
| Source Dataset Name | Gut microbiomes of Pimephales promelas (fathead minnow) during Triclosan exposure experiment - D14S2- solvent control exposure day 14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1812 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fish → Digestive System → Intestine → Unclassified → Pimephales Promelas Gut → Pimephales Promelas Gut Microbial Communities From The University Of Colorado, Denver, Usa, During Triclosan Exposure Experiment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denver, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 39.7392 | Long. (o) | -104.9847 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079293 | Metagenome | 116 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| D14S2_100645342 | F079293 | N/A | MAVASMDLGVWSWTRLLNSKLNIRMGKKGDLSNFERGMVVGARQAGLSISQSAHLLGFSHTTISWVYKEWCEKGKNIQYAAVLWAKMPCWCGARGQRRMGRLIQADRRAL* |
| ⦗Top⦘ |