Basic Information | |
---|---|
Taxon OID | 3300002514 Open in IMG/M |
Scaffold ID | JGI25133J35611_10061739 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Pacific Ocean - ETNP_6_85 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1214 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 18.92 | Long. (o) | -104.89 | Alt. (m) | Depth (m) | 85 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040869 | Metagenome | 161 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI25133J35611_100617391 | F040869 | GAGG | MNMKVFDQVYGELSLLQQEDKEDLQIAEESLTAAMIFTMTNAPSVLNGLCLISNTFNGILAE |
⦗Top⦘ |