NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24699J35502_10727669

Scaffold JGI24699J35502_10727669


Overview

Basic Information
Taxon OID3300002509 Open in IMG/M
Scaffold IDJGI24699J35502_10727669 Open in IMG/M
Source Dataset NameMicrocerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)794
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location NamePointe-Noire, Republic of the Congo
CoordinatesLat. (o)-4.7Long. (o)11.83Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035994Metagenome171Y

Sequences

Protein IDFamilyRBSSequence
JGI24699J35502_107276691F035994N/AHQHTHSSGPTPNYTKDTICCMCKEIVTSIAPEDGRVSPKHVELKVHK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.