| Basic Information | |
|---|---|
| Taxon OID | 3300002507 Open in IMG/M |
| Scaffold ID | JGI24697J35500_10979673 Open in IMG/M |
| Source Dataset Name | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 912 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Lepidosauria → Squamata → Bifurcata → Unidentata → Episquamata → Toxicofera → Serpentes → Colubroidea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pointe-Noire, Republic of the Congo | |||||||
| Coordinates | Lat. (o) | -4.7 | Long. (o) | 11.83 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094050 | Metagenome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24697J35500_109796731 | F094050 | N/A | EHTDAYSPHPVHIEMEEFSDVRFKQRAVIEFLTVEKAPPIEIHTRMQTVYGDQCVDVNTVRRWVR* |
| ⦗Top⦘ |