Scaffold JGI24705J35276_12120440

Overview

Basic Information

• Taxon OID: 3300002504
• Scaffold ID: JGI24705J35276_12120440
• Source Dataset Name: Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1071
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Petit - Saut dam, French Guiana
• Coordinates
  • Lat. (^o): 5.0626
  • Long. (^o): -53.0462

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002459	Metagenome	557	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24705J35276_121204404	F002459	N/A	MAKNFHNGTNIIAKHYTIFLGEEILEFFLAPMVKTHLSVLAQKLPAL*