| Basic Information | |
|---|---|
| Taxon OID | 3300002501 Open in IMG/M |
| Scaffold ID | JGI24703J35330_11286276 Open in IMG/M |
| Source Dataset Name | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 835 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Petit - Saut dam, French Guiana | |||||||
| Coordinates | Lat. (o) | 5.0626 | Long. (o) | -53.0462 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000366 | Metagenome | 1226 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24703J35330_112862761 | F000366 | N/A | LAVEPGSTPRPLVQKKTWRDSLPIDMLLSAVCVLVVAHSSSEIPEGLMKNPV* |
| ⦗Top⦘ |