Scaffold JGI24703J35330_10849624

Overview

Basic Information

• Taxon OID: 3300002501
• Scaffold ID: JGI24703J35330_10849624
• Source Dataset Name: Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 557
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Petit - Saut dam, French Guiana
• Coordinates
  • Lat. (^o): 5.0626
  • Long. (^o): -53.0462

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006225	Metagenome	378	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24703J35330_108496241	F006225	N/A	MAKAAFNKKKALFTSTLDLELRKKLVKCCIWSISLYGAETWTLRTVDQKRLESFEMWCWSRMEKISCTDHVRNDEVLLRVKEQRNILHEISKRKAN*