Scaffold JGI25128J35275_1048217

Overview

Basic Information

• Taxon OID: 3300002488
• Scaffold ID: JGI25128J35275_1048217
• Source Dataset Name: Marine viral communities from the Pacific Ocean - ETNP_2_60
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 933
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 18.92
  • Long. (^o): -108.7999

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005415	Metagenome	401	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25128J35275_10482171	F005415	N/A	RDNHYNDDKITLRDCEDQLRDWASTLAEREIERRPEGAKLRQLKDLKTKALDVVMESGTPDSLAIALDQVSKKIGLRWNQELQALPNFKQ*