Scaffold C687J35088_10096063

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold C687J35088_10096063

Scaffold C687J35088_10096063

Overview

Basic Information
Taxon OID	3300002485 Open in IMG/M
Scaffold ID	C687J35088_10096063 Open in IMG/M
Source Dataset Name	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	890
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location Name	Rifle, Colorado, United States
Coordinates	Lat. (^o)	39.534762	Long. (^o)	-107.782602	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064454	Metagenome / Metatranscriptome	128	N

Sequences

Protein ID	Family	RBS	Sequence
C687J35088_100960631	F064454	GGAGG	LVEDLERLLFEDIPEMETPRIKRCEWCHEPLPNDRYHLKICPQCRKESISIFMKGSLKPGTY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.