Scaffold JGI25127J35165_1046836

Overview

Basic Information

• Taxon OID: 3300002482
• Scaffold ID: JGI25127J35165_1046836
• Source Dataset Name: Marine viral communities from the Pacific Ocean - ETNP_2_30
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 947
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 18.92
  • Long. (^o): -108.7999

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006662	Metagenome / Metatranscriptome	367	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25127J35165_10468362	F006662	AGGAGG	MRTLTTKEYELISKIYNSTDEIEANVAFEFELQNDLYYHLFHSYEETK*