NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold metazooDRAFT_1468819

Scaffold metazooDRAFT_1468819


Overview

Basic Information
Taxon OID3300002471 Open in IMG/M
Scaffold IDmetazooDRAFT_1468819 Open in IMG/M
Source Dataset NameFreshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)713
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil

Source Dataset Sampling Location
Location NameSao Paulo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097201Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
metazooDRAFT_14688192F097201N/ATGIDSYRRNLGQLSVAVGNAAGDIEGNAKESIMMSSGKYREYYGRKEHPHWSSPPGTPPNADMGQAGLAGSIQSKMTGRTSAEVKVGAKYGIPLELGWMSQNGNHVPARPFLRPAVEKVAPSFQAACKVILKGGK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.