| Basic Information | |
|---|---|
| Taxon OID | 3300002471 Open in IMG/M |
| Scaffold ID | metazooDRAFT_1452774 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 626 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Paulo, Brazil | |||||||
| Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001840 | Metagenome / Metatranscriptome | 627 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| metazooDRAFT_14527742 | F001840 | N/A | MKEPDSKFLICDCYQHGLLVEKYPHDEEISLSIFERGLEGRILSFSERLRWCWQILRHGSPWSDFIILNTENQKQLKEFLK* |
| ⦗Top⦘ |