NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold metazooDRAFT_1450604

Scaffold metazooDRAFT_1450604


Overview

Basic Information
Taxon OID3300002471 Open in IMG/M
Scaffold IDmetazooDRAFT_1450604 Open in IMG/M
Source Dataset NameFreshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)617
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil

Source Dataset Sampling Location
Location NameSao Paulo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010611Metagenome / Metatranscriptome301N

Sequences

Protein IDFamilyRBSSequence
metazooDRAFT_14506041F010611N/AYVNYLMKKGMPMDSPEVADAWRAQNIRAKNIRRPTDPAPEECPAPEQEGPYRPAEASNPIDTATAATDSPEGAYERQRQIERAAYDLAVQALRQRRADAGRLVAIHAAAAKNLTSARDEVTNQAERERRLVSGDWVRRVMQEHDGAVASLLKAMPKQLSGRIAPHDPEHAERELTRWVQEVALKTLHQTDPWKS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.