Scaffold BRHa_1006102

Overview

Basic Information

• Taxon OID: 3300002468
• Scaffold ID: BRHa_1006102
• Source Dataset Name: Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - 10_samples_coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17187
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (52.17%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing

Source Dataset Sampling Location

• Location Name: Mt. Terri, Switzerland
• Coordinates
  • Lat. (^o): 47.379
  • Long. (^o): 7.1648
  • Depth (m): 300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079376	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
BRHa_100610222	F079376	GGAG	MFDIVIRREPGRPCASFGVSRVCRTTEEGGRQMRHRESDSLVVPMKAGNAAGGKEATHGSAV*